Click image to see more details
Product Info Summary
| SKU: | PROTQ63264 |
|---|---|
| Size: | 2ug, 10ug, 1mg |
| Origin Species: | Rat |
| Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL-1-beta Interleukin-1 beta Rat Recombinant Protein
View all IL-1 beta/IL-1F2 recombinant proteins
SKU/Catalog Number
PROTQ63264
Size
2ug, 10ug, 1mg
Description
Interleukin-1b Rat Recombinant produced in E. coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IL-1-beta Interleukin-1 beta Rat Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ63264)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Purity
Greater than 97.0% as determined by SDS-PAGE.
Predicted MW
30.748kDa
Reconstitution
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD IVDFTMEPVSS
Biological Activity
The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL1B (Source: Uniprot.org, NCBI)
Gene Name
IL1B
Full Name
Interleukin-1 beta
Weight
30.748kDa
Superfamily
IL-1 family
Alternative Names
Catabolin; Lymphocyte-activating factor (LAF); Endogenous Pyrogen (EP); Leukocyte Endogenous Mediator (LEM); Mononuclear Cell Factor (MCF); IL1F2; IL-1 beta IL1B IL-1, IL1-BETA, IL1F2, IL1beta interleukin 1 beta interleukin-1 beta|IL-1 beta|catabolin|interleukin 1beta|preinterleukin 1 beta|pro-interleukin-1-beta
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL1B, check out the IL1B Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL-1-beta Interleukin-1 beta Rat Recombinant Protein (PROTQ63264)
Hello CJ!
No publications found for PROTQ63264
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL-1-beta Interleukin-1 beta Rat Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IL-1-beta Interleukin-1 beta Rat Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
