Product Info Summary
SKU: | PROTP01584 |
---|---|
Size: | 2ug, 10ug, 1mg |
Origin Species: | Human |
Source: | HEK |
Customers Who Bought This Also Bought
Product info
Product Name
IL-1-beta Interleukin-1 beta Human Recombinant Protein, HEK
View all IL-1 beta/IL-1F2 recombinant proteins
SKU/Catalog Number
PROTP01584
Size
2ug, 10ug, 1mg
Description
Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation. The IL-1 beta is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Cite This Product
IL-1-beta Interleukin-1 beta Human Recombinant Protein, HEK (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01584)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The IL-1 beta was lyophilized from 1mg/ml in 1xPBS.
Purity
Greater than 95% as obsereved by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Amino Acid Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP VALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFES AQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Biological Activity
The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL1B (Source: Uniprot.org, NCBI)
Gene Name
IL1B
Full Name
Interleukin-1 beta
Weight
Superfamily
IL-1 family
Alternative Names
catabolin; IL1 beta; IL-1 beta; IL-1; IL1B; IL-1b; IL1-BETA; IL-1F2; IL1F2IL-1 beta; interleukin 1, beta; interleukin-1 beta; preinterleukin 1 beta; pro-interleukin-1-beta IL1B IL-1, IL1-BETA, IL1F2, IL1beta interleukin 1 beta interleukin-1 beta|IL-1 beta|catabolin|interleukin 1beta|preinterleukin 1 beta|pro-interleukin-1-beta
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL1B, check out the IL1B Infographic
![IL1B infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL-1-beta Interleukin-1 beta Human Recombinant Protein, HEK (PROTP01584)
Hello CJ!
PROTP01584 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Neutrophil activation and neutrophil-derived neutrophil extracellular trap formation in patients with coronary artery ectasia, Yuchao Guo, Ruifeng Liu, Lianfeng Chen,Wei Wu, and Shuyang Zhang BMC Cardiovascular Disorders
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL-1-beta Interleukin-1 beta Human Recombinant Protein, HEK?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IL-1-beta Interleukin-1 beta Human Recombinant Protein, HEK
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question