IFT43 (NM_052873) Human Recombinant Protein

Ift43 protein,

Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1

Product Info Summary

SKU: PROTQ96FT9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

IFT43 (NM_052873) Human Recombinant Protein

View all Ift43 recombinant proteins

SKU/Catalog Number

PROTQ96FT9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IFT43 (NM_052873) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96FT9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.7 kDa

Amino Acid Sequence

MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT

Validation Images & Assay Conditions

Gene/Protein Information For IFT43 (Source: Uniprot.org, NCBI)

Gene Name

IFT43

Full Name

Intraflagellar transport protein 43 homolog

Weight

23.7 kDa

Superfamily

IFT43 family

Alternative Names

Intraflagellar transport protein 43 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFT43, check out the IFT43 Infographic

IFT43 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFT43: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96FT9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IFT43 (NM_052873) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IFT43 (NM_052873) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IFT43 (NM_052873) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96FT9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product