HYKK (NM_001013619) Human Recombinant Protein

Hydroxylysine kinase protein,

Product Info Summary

SKU: PROTA2RU49
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HYKK (NM_001013619) Human Recombinant Protein

View all Hydroxylysine kinase recombinant proteins

SKU/Catalog Number

PROTA2RU49

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human similar to RIKEN cDNA C630028N24 gene (LOC123688), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HYKK (NM_001013619) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA2RU49)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.8 kDa

Amino Acid Sequence

MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECINHGDLNDHNILIESSKSASGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSPIQVGGHVLAGFESITPLTAVEKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFDMGQKAVEEIWFETAKSYESGISM

Validation Images & Assay Conditions

Gene/Protein Information For HYKK (Source: Uniprot.org, NCBI)

Gene Name

HYKK

Full Name

Hydroxylysine kinase

Weight

41.8 kDa

Superfamily

aminoglycoside phosphotransferase family

Alternative Names

Nothing Found HYKK AGPHD1 hydroxylysine kinase hydroxylysine kinase|5-hydroxy-L-lysine kinase|5-hydroxylysine kinase|aminoglycoside phosphotransferase domain-containing protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HYKK, check out the HYKK Infographic

HYKK infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HYKK: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA2RU49

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HYKK (NM_001013619) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HYKK (NM_001013619) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HYKK (NM_001013619) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA2RU49
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.