Click image to see more details
Product Info Summary
| SKU: | PROTQ14213-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF
View all EBI3 recombinant proteins
SKU/Catalog Number
PROTQ14213-3
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 27 EBI3 (IL-27 EI3) predicts a molecular mass of 23.4 kDa. IL-27 is a heterodimeric cytokine that is encoded by Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. It is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R).
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14213-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
25.396kDa
Molecular weight
The protein has a calculated MW of 24.25 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce TF-1 cells proliferation using a concentration range of 20-200 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK with polyhistidine tag at the C-terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-27 EBI3
Protein Target Info & Infographic
Gene/Protein Information For EBI3 (Source: Uniprot.org, NCBI)
Gene Name
EBI3
Full Name
Interleukin-27 subunit beta
Weight
25.396kDa
Superfamily
type I cytokine receptor family
Alternative Names
Epstein-Barr virus induced 3, Interleukin-27 subunit beta, IL-27B, EBI3, p28, IL35B EBI3 IL-27B, IL27B, IL35B Epstein-Barr virus induced 3 interleukin-27 subunit beta|EBV-induced gene 3 protein|Epstein-Barr virus induced gene 3|IL-27 subunit beta|IL27 subunit|IL35 subunit|cytokine receptor|epstein-Barr virus-induced gene 3 protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on EBI3, check out the EBI3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for EBI3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF (PROTQ14213-3)
Hello CJ!
No publications found for PROTQ14213-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
