Click image to see more details
Product Info Summary
| SKU: | PROTP18510-5 |
|---|---|
| Size: | 20ug,100ug,500ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF
View all IL-1ra/IL-1F3/IL1RN recombinant proteins
SKU/Catalog Number
PROTP18510-5
Size
20ug,100ug,500ug
Tag
His Tag (C-term)
Description
Interleukin 1 receptor antagonist (IL-1RA) is a 17.26 kDa member of IL-1 family with 153 amino acid residues. IL-1RA is expressed by peripheral blood cells, lungs, spleen, liver and is secreted from monocytes, macrophages, neutrophils, and other cells. Inhibits the activity of interleukin-1 by binding to receptor IL1R1. IL-1RA can modulate a variety of interleukin-1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18510-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
20.055kDa
Molecular weight
The protein has a calculated MW of 18.07 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to inhibit IL-1 alpha -dependent proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <50 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-1RA
Protein Target Info & Infographic
Gene/Protein Information For IL1RN (Source: Uniprot.org, NCBI)
Gene Name
IL1RN
Full Name
Interleukin-1 receptor antagonist protein
Weight
20.055kDa
Alternative Names
ICIL-1RA, IRAP, IL-1RN IL1RN DIRA, ICIL-1RA, IL-1RN, IL-1ra, IL-1ra3, IL1F3, IL1RA, IRAP, MVCD4 interleukin 1 receptor antagonist interleukin-1 receptor antagonist protein|IL1 inhibitor|intracellular IL-1 receptor antagonist type II|intracellular interleukin-1 receptor antagonist (icIL-1ra)|type II interleukin-1 receptor antagonist
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL1RN, check out the IL1RN Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL1RN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF (PROTP18510-5)
Hello CJ!
No publications found for PROTP18510-5
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
