Click image to see more details
Product Info Summary
| SKU: | PROTP29459-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | HEK293 cell |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-12 (p70) (Interleukin-12 p70) protein, AF
View all IL12A recombinant proteins
SKU/Catalog Number
PROTP29459-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 12 p70 (IL-12 p70) is an interleukin which is major secreted from immune cells like dendritic cells, macrophages and neutrophils. IL-12 p70 is a 58.5 kDa protein containing 527 amino acid residues which is composed by two subunits (IL-12 p35 and IL-12 p40). IL-12 p70 induces the cytotoxic activity of immune cells like NK cells and T cells. IL-12 p70 binds its receptor (IL-12Rβ1 and IL-12Rβ2) that activates the Jak/STAT signaling pathway. IL-12 p70 also plays an important role in cancer model which inhibits the formation of new blood vessels through the production of IFN γ.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-12 (p70) (Interleukin-12 p70) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP29459-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
24.874kDa
Molecular weight
The protein has a calculated MW of 59.55 kDa. The protein migrates as 63-75 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IFN gamma secretion in PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is 0.05-0.2 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGSTSGSGKPGSGEGSTKGRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-12 p70
Protein Target Info & Infographic
Gene/Protein Information For IL12A (Source: Uniprot.org, NCBI)
Gene Name
IL12A
Full Name
Interleukin-12 subunit alpha
Weight
24.874kDa
Superfamily
IL-6 superfamily
Alternative Names
Interleukin-12, NKSF,Cytotoxic Lymphocyte Maturation Factor (CLMF), TSF IL12A CLMF, IL-12A, NFSK, NKSF1, P35 interleukin 12A interleukin-12 subunit alpha|CLMF p35|IL-12, subunit p35|IL35 subunit|NF cell stimulatory factor chain 1|NK cell stimulatory factor chain 1|cytotoxic lymphocyte maturation factor 1, p35|cytotoxic lymphocyte maturation factor 35 kDa subunit|interleukin 12, p35|interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)|interleukin-12 alpha chain
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL12A, check out the IL12A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL12A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-12 (p70) (Interleukin-12 p70) protein, AF (PROTP29459-2)
Hello CJ!
No publications found for PROTP29459-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-12 (p70) (Interleukin-12 p70) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-12 (p70) (Interleukin-12 p70) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
