Click image to see more details
Product Info Summary
| SKU: | PROTP27352-1 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant GIF (Gastric intrinsic factor) protein, AF
View all CBLIF recombinant proteins
SKU/Catalog Number
PROTP27352-1
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Human Gastric intrinsic factor (GIF) is an intrinsic factor of the eukaryotic cobalamin family. Gastric intrinsic factor is a 44 kDa protein containing 380 amino acid residues. It is secreted from the parietal cells in gastric mucosa. Gastric intrinsic factor plays a major role in absorption and transportation of cobalamin and Cbl. It could form the comprised with Vit.B12 that avoid the destroy of Vit.B12.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant GIF (Gastric intrinsic factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP27352-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
45.416kDa
Molecular weight
The protein has a calculated MW of 46.23 kDa. The protein migrates as 45 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human GIF
Protein Target Info & Infographic
Gene/Protein Information For CBLIF (Source: Uniprot.org, NCBI)
Gene Name
CBLIF
Full Name
Cobalamin binding intrinsic factor
Weight
45.416kDa
Superfamily
eukaryotic cobalamin transport proteins family
Alternative Names
CBLIF, IF, IFMH, INF, TCN3 CBLIF GIF, IF, IFMH, INF, TCN3 cobalamin binding intrinsic factor cobalamin binding intrinsic factor|gastric intrinsic factor (vitamin B synthesis)|intrinsic factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CBLIF, check out the CBLIF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CBLIF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant GIF (Gastric intrinsic factor) protein, AF (PROTP27352-1)
Hello CJ!
No publications found for PROTP27352-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant GIF (Gastric intrinsic factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant GIF (Gastric intrinsic factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
