Product Info Summary
SKU: | PROTQ9NP95-2 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Human |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant FGF-20 (Fibroblast growth factor-20) protein, AF
View all FGF-20 recombinant proteins
SKU/Catalog Number
PROTQ9NP95-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Fibroblast Growth Factors-20 (FGF-20) is a 23.5 kDa member of the fibroblast Growth Factors with 211 amino acid residues. FGF-20 is mainly expressed from microglial cells. FGF-20 can regulate central nervous development and function, regulate the survival of dopaminergic neurons via FGF/FGFR-dependent signaling pathway.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant FGF-20 (Fibroblast growth factor-20) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NP95-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
23.499kDa
Molecular weight
The protein has a calculated MW of 24.24 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is 1.3-3.2 ng/mL. The specific activity of recombinant human FGF-20 is > 2 x 10⁵ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human FGF-20
Protein Target Info & Infographic
Gene/Protein Information For FGF20 (Source: Uniprot.org, NCBI)
Gene Name
FGF20
Full Name
Fibroblast growth factor 20
Weight
23.499kDa
Superfamily
heparin-binding growth factors family
Alternative Names
FGFK FGF20 FGF-20, RHDA2 fibroblast growth factor 20 fibroblast growth factor 20
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on FGF20, check out the FGF20 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FGF20: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant FGF-20 (Fibroblast growth factor-20) protein, AF (PROTQ9NP95-2)
Hello CJ!
No publications found for PROTQ9NP95-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant FGF-20 (Fibroblast growth factor-20) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant FGF-20 (Fibroblast growth factor-20) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question