Human recombinant FGF-10 (Fibroblast growth factor-10) protein, AF

FGF-10 protein, Human

Fibroblast Growth Factors-10 (FGF-10) is a 23.4 kDa member of the fibroblast Growth Factors with 208 amino acid residues. FGF-10 is mainly secreted from endometrial stromal cells, fibroblasts, peritubular cells, leydig cells, muller glia cells. FGF-10 a multifunctional mesenchymal-epithelial signaling Growth Factors, can regulate embryonic development, cell proliferation and cell differentiation. It has been associated with cancer and human genetic disorders.

Product Info Summary

SKU: PROTO15520-4
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Customers Who Bought This Also Bought

Product Name

Human recombinant FGF-10 (Fibroblast growth factor-10) protein, AF

View all FGF-10 recombinant proteins

SKU/Catalog Number

PROTO15520-4

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Fibroblast Growth Factors-10 (FGF-10) is a 23.4 kDa member of the fibroblast Growth Factors with 208 amino acid residues. FGF-10 is mainly secreted from endometrial stromal cells, fibroblasts, peritubular cells, leydig cells, muller glia cells. FGF-10 a multifunctional mesenchymal-epithelial signaling Growth Factors, can regulate embryonic development, cell proliferation and cell differentiation. It has been associated with cancer and human genetic disorders.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant FGF-10 (Fibroblast growth factor-10) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15520-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

23.436kDa

Molecular weight

The protein has a calculated MW of 20.06 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <8 ng/mL. The specific activity of recombinant human FGF-10 is > 1.2 x 10⁵ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For FGF10 (Source: Uniprot.org, NCBI)

Gene Name

FGF10

Full Name

Fibroblast growth factor 10

Weight

23.436kDa

Superfamily

heparin-binding growth factors family

Alternative Names

FGFA, Keratinocyte Growth Factor-2 FGF10 fibroblast growth factor 10 fibroblast growth factor 10|FGF-10|keratinocyte growth factor 2|produced by fibroblasts of urinary bladder lamina propria

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FGF10, check out the FGF10 Infographic

FGF10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGF10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15520-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant FGF-10 (Fibroblast growth factor-10) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant FGF-10 (Fibroblast growth factor-10) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant FGF-10 (Fibroblast growth factor-10) protein, AF

Size

Total: $77

SKU:PROTO15520-4

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTO15520-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.