Click image to see more details
Product Info Summary
| SKU: | PROTP01133-5 |
|---|---|
| Size: | 100ug,500ug,1mg,5mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant EGF (Epidermal growth factor) protein, AF
View all EGF recombinant proteins
SKU/Catalog Number
PROTP01133-5
Size
100ug,500ug,1mg,5mg
Tag
His Tag (C-term)
Description
Human epidermal Growth Factors (EGF) is a 6 kDa cytokine with 53 amino acid residues. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epithelial cells, play important roles in many developmental processes including accelerate tooth eruption, inhibits gastric acid secretion, and involve in wound healing.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant EGF (Epidermal growth factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01133-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
133.994kDa
Molecular weight
The protein has a calculated MW of 7.16 kDa. The protein migrates as 9-11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is < 1.0 ng/mL. The specific activity of recombinant human EGF is approximately >1.0 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR with polyhistidine tag at the C-terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human EGF
Protein Target Info & Infographic
Gene/Protein Information For EGF (Source: Uniprot.org, NCBI)
Gene Name
EGF
Full Name
Pro-epidermal growth factor
Weight
133.994kDa
Alternative Names
Urogastrone, URG EGF HOMG4, URG epidermal growth factor pro-epidermal growth factor|beta-urogastrone
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on EGF, check out the EGF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for EGF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant EGF (Epidermal growth factor) protein, AF (PROTP01133-5)
Hello CJ!
No publications found for PROTP01133-5
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant EGF (Epidermal growth factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant EGF (Epidermal growth factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
