Click image to see more details
Product Info Summary
| SKU: | PROTP19875-4 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF
View all CXCL2 recombinant proteins
SKU/Catalog Number
PROTP19875-4
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
C-X-C motif chemokine 2 (CXCL2) also named Growth-regulated oncogene beta (GROβ), which is a chemokine of the intercrine alpha family. CXCL2 is a 8 kDa protein containing 73 amino acid residues. CXCL2 is expressed in immune cells such as macrophages and monocytes. CXCL2 plays an important role with immune responses and cancer progression. CXCL2 activates the cell signal transduction with casepas1 that affect the cell proliferation, differentiation and migration.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19875-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
11.389kDa
Molecular weight
The protein has a calculated MW of 8.70 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human CXCL2
Protein Target Info & Infographic
Gene/Protein Information For CXCL2 (Source: Uniprot.org, NCBI)
Gene Name
CXCL2
Full Name
C-X-C motif chemokine 2
Weight
11.389kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
Growth Regulated Protein/Melanoma Growth Stimulatory Activity,GRO-β: MGSAβ,MIP-2α, GRO2 CXCL2 CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2 C-X-C motif chemokine ligand 2 C-X-C motif chemokine 2|GRO2 oncogene|MGSA beta|MIP2-alpha|chemokine (C-X-C motif) ligand 2|gro-beta|growth-regulated protein beta|macrophage inflammatory protein 2-alpha|melanoma growth stimulatory activity beta
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CXCL2, check out the CXCL2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CXCL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF (PROTP19875-4)
Hello CJ!
No publications found for PROTP19875-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
