Array
(
[0] => store_id
[1] => entity_id
[2] => attribute_set_id
[3] => type_id
[4] => sku
[5] => has_options
[6] => required_options
[7] => created_at
[8] => updated_at
[9] => mst_search_weight
[10] => status
[11] => name
[12] => cj_search_index
[13] => publication_count
[14] => qty_in_warehouses
[15] => is_recurring
[16] => visibility
[17] => tax_class_id
[18] => featured
[19] => featured_image
[20] => fb_product
[21] => custom_product_page
[22] => template
[23] => quantity_and_stock_status
[24] => googleshopping_exclude
[25] => description
[26] => short_description
[27] => meta_keyword
[28] => contents
[29] => gene_name
[30] => description_after_attributes
[31] => purification
[32] => storage
[33] => tag
[34] => meta_title
[35] => url_key
[36] => options_container
[37] => msrp_display_actual_price_type
[38] => gift_message_available
[39] => size
[40] => uniprot_id
[41] => applications
[42] => reactivity
[43] => form
[44] => source
[45] => source_company
[46] => product_category
[47] => mp_exclude_sitemap
[48] => price
[49] => weight
[50] => options
[51] => media_gallery
[52] => extension_attributes
[53] => tier_price
[54] => tier_price_changed
[55] => category_ids
[56] => is_salable
[57] => website_ids
[58] => request_path
[59] => rating_summary
[60] => _cache_instance_store_filter
[61] => media_gallery_images
)
Key=store_id Key=entity_id, value=127626 Key=attribute_set_id, value=16 Key=type_id, value=simple Key=sku, value=PROTQ96S42 Key=has_options, value=1 Key=required_options, value=1 Key=created_at, value=2024-11-12 02:16:00 Key=updated_at, value=2024-11-12 06:01:34 Key=mst_search_weight, value=0 Key=status, value=Enabled Key=name, value=Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF Key=cj_search_index Key=publication_count, value=0 Key=qty_in_warehouses Key=is_recurring, value=No Key=visibility, value=Catalog, Search Key=tax_class_id, value=Taxable Goods Key=featured, value=No Key=featured_image, value=Yes Key=fb_product, value= Key=custom_product_page, value=No Key=template, value=proteins Key=quantity_and_stock_status Key=googleshopping_exclude, value=No Key=description, value=Bone morphogenetic protein 16 (BMP-16) predicts a molecular mass of 18 kDa. BMPs are multi-functional Growth Factorss that belong to the transforming Growth Factors beta (TGF-β) superfamily. BMPs initiate signaling from the cell surface by binding to two different receptors (R: Type I and II). The heterodimeric formation of type I R and II R may occur before or after BMP binding, inducing signal transduction pathways through SMADs. Key=short_description, value=Bone morphogenetic protein 16 (BMP-16) predicts a molecular mass of 18 kDa. BMPs are multi-functional Growth Factorss that belong to the transforming Growth Factors beta (TGF-β) superfamily. BMPs initiate signaling from the cell surface by binding to two different receptors (R: Type I and II). The heterodimeric formation of type I R and II R may occur before or after BMP binding, inducing signal transduction pathways through SMADs. Key=meta_keyword, value=Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF Key=contents, value=The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. Key=gene_name, value=NODAL Key=description_after_attributes, value=
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL with polyhistidine tag at the C-terminus.
Key=purification, value=>98% as determined by SDS-PAGE. Key=storage, value=Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. Key=tag, value=His Tag (C-term) Key=meta_title, value=Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF Key=url_key, value=human-recombinant-bmp-16-bone-morphogenetic-protein-16-protein-af-protq96s42-boster Key=options_container, value=Product Info Column Key=msrp_display_actual_price_type, value=Use config Key=gift_message_available, value=No Key=size, value=5ug,20ug,100ug,500ug,1mg Key=uniprot_id, value=Q96S42 Key=applications, value=Cell Culture Key=reactivity, value=Human Key=form, value=Lyophilized Key=source, value=Escherichia coli Key=source_company, value=Chamot CM078-5HP/20HP/100HP/500HP/1000HP; Cost: 5ug¥300, 20ug ¥750, 100ug ¥2250, 500ug ¥6500, 1mg ¥10000 Key=product_category, value=Recombinant Proteins Key=mp_exclude_sitemap, value=No Key=price, value=77.0000 Key=weight, value=1.0000 Key=options Key=media_gallery Key=extension_attributes Key=tier_price Key=tier_price_changed Key=category_ids Key=is_salable Key=website_ids Key=request_path Key=rating_summary Key=_cache_instance_store_filter Key=media_gallery_images
Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF
NODAL protein, Human
Bone morphogenetic protein 16 (BMP-16) predicts a molecular mass of 18 kDa. BMPs are multi-functional Growth Factorss that belong to the transforming Growth Factors beta (TGF-β) superfamily. BMPs initiate signaling from the cell surface by binding to two different receptors (R: Type I and II). The heterodimeric formation of type I R and II R may occur before or after BMP binding, inducing signal transduction pathways through SMADs.
Bone morphogenetic protein 16 (BMP-16) predicts a molecular mass of 18 kDa. BMPs are multi-functional Growth Factorss that belong to the transforming Growth Factors beta (TGF-β) superfamily. BMPs initiate signaling from the cell surface by binding to two different receptors (R: Type I and II). The heterodimeric formation of type I R and II R may occur before or after BMP binding, inducing signal transduction pathways through SMADs.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96S42)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
39.561kDa
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL with polyhistidine tag at the C-terminus.
There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".
For more info on NODAL, check out the NODAL Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NODAL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].