Product Info Summary
SKU: | PROTP01138-5 |
---|---|
Size: | 20ug,100ug,500ug |
Origin Species: | Human |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant beta-NGF (Nerve growth factor-beta) protein, AF
View all beta-NGF recombinant proteins
SKU/Catalog Number
PROTP01138-5
Size
20ug,100ug,500ug
Tag
His Tag (C-term)
Description
Nerve Growth Factors (NGF) is critical for the development and maintenance of the sympathetic and sensory neuron systems. NGF has been demonstrated as a complex that consists of three polypeptides named α, β and γ subunits. Among then, β subunit, which known as beta-NGF is a 26.9 kDa protein containing 241 residues that involve in neuronal survival and differentiation. Besides, beta-NGF also acts as a ligand to TRKA receptor, which indispensable for the differentiation and development of pain and temperature sensing neurons.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant beta-NGF (Nerve growth factor-beta) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01138-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
26.959kDa
Molecular weight
The protein has a calculated MW of 14.43 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.7 ng/mL. The specific activity of recombinant human beta-NGF is > 1 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human beta-NGF
Protein Target Info & Infographic
Gene/Protein Information For NGF (Source: Uniprot.org, NCBI)
Gene Name
NGF
Full Name
Beta-nerve growth factor
Weight
26.959kDa
Superfamily
NGF-beta family
Alternative Names
β-Nerve Growth Factor, NGF-β NGF Beta-NGF, HSAN5B, NGF nerve growth factor beta-nerve growth factor|nerve growth factor (beta polypeptide)|nerve growth factor, beta subunit|pro-nerve growth factor long
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on NGF, check out the NGF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NGF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant beta-NGF (Nerve growth factor-beta) protein, AF (PROTP01138-5)
Hello CJ!
No publications found for PROTP01138-5
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant beta-NGF (Nerve growth factor-beta) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant beta-NGF (Nerve growth factor-beta) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question