Click image to see more details
Product Info Summary
| SKU: | PROTP26583-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | HEK293 cell |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human (mammalian cell expression) recombinant HMGB2 protein, AF
View all HMGB2 recombinant proteins
SKU/Catalog Number
PROTP26583-3
Size
5ug,20ug,100ug
Tag
His-SUMO Tag (N-term)
Description
High Mobility Group protein B2, also known as HMGB2, is a member of the non-histone chromosomal high-mobility group protein family. HMGB2 is expressed 25 kDa containing 209 amino acid residues. The function of HMGB2 is involved in transcription, chromatin remodeling and V(D)J recombination. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles .
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human (mammalian cell expression) recombinant HMGB2 protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP26583-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
24.034kDa
Molecular weight
The protein has a calculated MW of 35.57 kDa. The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE with polyhistidine-SUMO tag at the N-terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human HMGB2
Protein Target Info & Infographic
Gene/Protein Information For HMGB2 (Source: Uniprot.org, NCBI)
Gene Name
HMGB2
Full Name
High mobility group protein B2
Weight
24.034kDa
Superfamily
HMGB family
Alternative Names
HMG2 HMGB2 HMG2 high mobility group box 2 high mobility group protein B2|HMG-2|high mobility group protein 2|high-mobility group (nonhistone chromosomal) protein 2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on HMGB2, check out the HMGB2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HMGB2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human (mammalian cell expression) recombinant HMGB2 protein, AF (PROTP26583-3)
Hello CJ!
No publications found for PROTP26583-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human (mammalian cell expression) recombinant HMGB2 protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human (mammalian cell expression) recombinant HMGB2 protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
