HOXB7 (NM_004502) Human Recombinant Protein

HOXB7 protein,

Recombinant protein of human homeobox B7 (HOXB7)

Product Info Summary

SKU: PROTP09629
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HOXB7 (NM_004502) Human Recombinant Protein

View all HOXB7 recombinant proteins

SKU/Catalog Number

PROTP09629

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human homeobox B7 (HOXB7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HOXB7 (NM_004502) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09629)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.8 kDa

Amino Acid Sequence

MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE

Validation Images & Assay Conditions

Gene/Protein Information For HOXB7 (Source: Uniprot.org, NCBI)

Gene Name

HOXB7

Full Name

Homeobox protein Hox-B7

Weight

23.8 kDa

Superfamily

Antp homeobox family

Alternative Names

HHO.C1; homeo box 2C; homeo box B7; homeo box c1 protein; homeobox B7; Homeobox protein HHO.C1; Homeobox protein Hox-2C; homeobox protein Hox-B7; HOX2; Hox-2.3; HOX2C; HOX2CHox-2.3; HOXB7 HOXB7 HHO.C1, HOX2, HOX2C, Hox-2.3 homeobox B7 homeobox protein Hox-B7|homeo box 2C|homeo box B7|homeo box c1 protein|homeobox protein HHO.C1|homeobox protein Hox-2C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HOXB7, check out the HOXB7 Infographic

HOXB7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HOXB7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09629

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HOXB7 (NM_004502) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HOXB7 (NM_004502) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HOXB7 (NM_004502) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP09629
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product