HNRPAB (HNRNPAB) (NM_031266) Human Recombinant Protein

hnRNP AB protein,

Product Info Summary

SKU: PROTQ99729
Size: 20 µg
Source: HEK293T

Product Name

HNRPAB (HNRNPAB) (NM_031266) Human Recombinant Protein

View all hnRNP AB recombinant proteins

SKU/Catalog Number

PROTQ99729

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HNRPAB (HNRNPAB) (NM_031266) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99729)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.8 kDa

Amino Acid Sequence

MSEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY

Validation Images & Assay Conditions

Gene/Protein Information For HNRNPAB (Source: Uniprot.org, NCBI)

Gene Name

HNRNPAB

Full Name

Heterogeneous nuclear ribonucleoprotein A/B

Weight

35.8 kDa

Alternative Names

catalytic polypeptide 1-binding protein 1; heterogeneous nuclear ribonucleoprotein A/B; hnRNP A/B; hnRNP type A/B protein HNRNPAB ABBP1, HNRPAB heterogeneous nuclear ribonucleoprotein A/B heterogeneous nuclear ribonucleoprotein A/B|ABBP-1|APOBEC1-binding protein 1|apobec-1 binding protein 1|apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1-binding protein 1|hnRNP A/B|hnRNP type A/B protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HNRNPAB, check out the HNRNPAB Infographic

HNRNPAB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HNRNPAB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99729

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HNRPAB (HNRNPAB) (NM_031266) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HNRPAB (HNRNPAB) (NM_031266) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HNRPAB (HNRNPAB) (NM_031266) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99729
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.