GTSF1L (NM_001008901) Human Recombinant Protein

Gtsf1l protein,

Recombinant protein of human gametocyte specific factor 1-like (GTSF1L), transcript variant 2

Product Info Summary

SKU: PROTQ9H1H1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GTSF1L (NM_001008901) Human Recombinant Protein

View all Gtsf1l recombinant proteins

SKU/Catalog Number

PROTQ9H1H1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human gametocyte specific factor 1-like (GTSF1L), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GTSF1L (NM_001008901) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H1H1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14 kDa

Amino Acid Sequence

MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQTFFPQKVVCENDTKESARETSPQKILRPGQ

Validation Images & Assay Conditions

Gene/Protein Information For GTSF1L (Source: Uniprot.org, NCBI)

Gene Name

GTSF1L

Full Name

Gametocyte-specific factor 1-like

Weight

14 kDa

Superfamily

UPF0224 (FAM112) family

Alternative Names

C20orf65; chromosome 20 open reading frame 65; dJ1028D15.4; FAM112A; family with sequence similarity 112, member A; gametocyte specific factor 1-like; gametocyte-specific factor 1-like; MGC50820; Protein FAM112A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GTSF1L, check out the GTSF1L Infographic

GTSF1L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GTSF1L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H1H1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GTSF1L (NM_001008901) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GTSF1L (NM_001008901) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GTSF1L (NM_001008901) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H1H1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.