GJB4 (NM_153212) Human Recombinant Protein

Connexin 30.3/GJB4 protein,

Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4)

Product Info Summary

SKU: PROTQ9NTQ9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GJB4 (NM_153212) Human Recombinant Protein

View all Connexin 30.3/GJB4 recombinant proteins

SKU/Catalog Number

PROTQ9NTQ9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GJB4 (NM_153212) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NTQ9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.2 kDa

Amino Acid Sequence

MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP

Validation Images & Assay Conditions

Gene/Protein Information For GJB4 (Source: Uniprot.org, NCBI)

Gene Name

GJB4

Full Name

Gap junction beta-4 protein

Weight

30.2 kDa

Superfamily

connexin family

Alternative Names

beta 4; Connexin 30.3; connexin-30.3; CX30.3; EKV; gap junction beta-4 protein; gap junction protein, beta 4 (connexin 30.3); gap junction protein, beta 4, 30.3kDa; GJB4; MGC21116 Gjb4|Cnx30.3, Cx30.3, Cxnb, Gjb-4|gap junction protein, beta 4|gap junction beta-4 protein|connexin b|connexin-30.3|gap junction membrane channel protein beta 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GJB4, check out the GJB4 Infographic

GJB4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GJB4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NTQ9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GJB4 (NM_153212) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GJB4 (NM_153212) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GJB4 (NM_153212) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NTQ9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.