GAS41 (YEATS4) (NM_006530) Human Recombinant Protein

GAS41 protein,

Product Info Summary

SKU: PROTO95619
Size: 20 µg
Source: HEK293T

Product Name

GAS41 (YEATS4) (NM_006530) Human Recombinant Protein

View all GAS41 recombinant proteins

SKU/Catalog Number

PROTO95619

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens YEATS domain containing 4 (YEATS4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GAS41 (YEATS4) (NM_006530) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95619)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.3 kDa

Amino Acid Sequence

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Validation Images & Assay Conditions

Gene/Protein Information For YEATS4 (Source: Uniprot.org, NCBI)

Gene Name

YEATS4

Full Name

YEATS domain-containing protein 4

Weight

26.3 kDa

Alternative Names

B230215M10Rik; Gas41,4930573H17Rik; GAS41glioma-amplified sequence-41; Glioma-amplified sequence 41; nuBI1; NUBI-1; NuMA binding protein 1; NuMA-binding protein 1; YAF9; YEATS domain containing 4; YEATS domain-containing protein 4 YEATS4 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9 YEATS domain containing 4 YEATS domain-containing protein 4|NuMA binding protein 1|glioma-amplified sequence 41|nuBI1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on YEATS4, check out the YEATS4 Infographic

YEATS4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for YEATS4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95619

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GAS41 (YEATS4) (NM_006530) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GAS41 (YEATS4) (NM_006530) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GAS41 (YEATS4) (NM_006530) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95619
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product