gamma C Crystallin (CRYGC) (NM_020989) Human Recombinant Protein

gamma C Crystallin protein,

Product Info Summary

SKU: PROTP07315
Size: 20 µg
Source: HEK293T

Product Name

gamma C Crystallin (CRYGC) (NM_020989) Human Recombinant Protein

View all gamma C Crystallin recombinant proteins

SKU/Catalog Number

PROTP07315

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human crystallin, gamma C (CRYGC)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

gamma C Crystallin (CRYGC) (NM_020989) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP07315)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.7 kDa

Amino Acid Sequence

MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY

Validation Images & Assay Conditions

Gene/Protein Information For CRYGC (Source: Uniprot.org, NCBI)

Gene Name

CRYGC

Full Name

Gamma-crystallin C

Weight

20.7 kDa

Superfamily

beta/gamma-crystallin family

Alternative Names

CCL; CRYG3gamma-C-crystallin; crystallin, gamma C; crystallin, gamma-3; Gamma-C-crystallin; Gamma-crystallin 2-1; Gamma-crystallin 3; gamma-crystallin C CRYGC CCL, CRYG3, CTRCT2 crystallin gamma C gamma-crystallin C|gamma-crystallin 2-1|gamma-crystallin 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRYGC, check out the CRYGC Infographic

CRYGC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRYGC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP07315

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used gamma C Crystallin (CRYGC) (NM_020989) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For gamma C Crystallin (CRYGC) (NM_020989) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for gamma C Crystallin (CRYGC) (NM_020989) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP07315
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.