Galactoside 2 alpha L fucosyltransferase 1 (FUT1) (NM_000148) Human Recombinant Protein

Blood group H inhibitor protein,

Recombinant protein of human fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) (FUT1)

Product Info Summary

SKU: PROTP19526
Size: 20 µg
Source: HEK293T

Product Name

Galactoside 2 alpha L fucosyltransferase 1 (FUT1) (NM_000148) Human Recombinant Protein

View all Blood group H inhibitor recombinant proteins

SKU/Catalog Number

PROTP19526

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) (FUT1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Galactoside 2 alpha L fucosyltransferase 1 (FUT1) (NM_000148) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19526)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.1 kDa

Amino Acid Sequence

MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP

Validation Images & Assay Conditions

Gene/Protein Information For FUT1 (Source: Uniprot.org, NCBI)

Gene Name

FUT1

Full Name

Galactoside 2-alpha-L-fucosyltransferase 1

Weight

41.1 kDa

Superfamily

glycosyltransferase 11 family

Alternative Names

alpha (1,2) fucosyltransferase; Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase; Blood group H alpha 2-fucosyltransferase; EC 2.4.1.69; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included); fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); Fucosyltransferase 1; galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; HHH; HSC FUT1 H, HH, HSC fucosyltransferase 1 (H blood group) galactoside alpha-(1,2)-fucosyltransferase 1|GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1|H glycosyltransferase|H glycosytransferase|alpha(1,2) fucosyltransferase 1|alpha(1,2)FT 1|blood group H alpha 2-fucosyltransferase|galactoside 2-L-fucosyltransferase enzyme|galactoside 2-alpha-L-fucosyltransferase|nonfunctional fucosyltransferase 1|truncated FUT1|truncated alpha(1,2)fucosyltransferase|truncated fucosyltransferase 1|type 1 galactoside alpha-(1,2)-fucosyltransferase FUT1|type 2 galactoside alpha-(1,2)-fucosyltransferase FUT1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FUT1, check out the FUT1 Infographic

FUT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FUT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP19526

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Galactoside 2 alpha L fucosyltransferase 1 (FUT1) (NM_000148) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Galactoside 2 alpha L fucosyltransferase 1 (FUT1) (NM_000148) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Galactoside 2 alpha L fucosyltransferase 1 (FUT1) (NM_000148) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP19526
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.