FOXI2 (NM_207426) Human Recombinant Protein

Forkhead box I2 protein,

Purified recombinant protein of Homo sapiens forkhead box I2 (FOXI2).

Product Info Summary

SKU: PROTQ6ZQN5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FOXI2 (NM_207426) Human Recombinant Protein

View all Forkhead box I2 recombinant proteins

SKU/Catalog Number

PROTQ6ZQN5

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens forkhead box I2 (FOXI2).

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FOXI2 (NM_207426) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6ZQN5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.8 kDa

Amino Acid Sequence

MATYCDDLGPSSAPPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPAPPYAAPSYGAPGPLLGAPGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPEAATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTAAAGFRLSHLLYSREGTEV

Validation Images & Assay Conditions

Gene/Protein Information For FOXI2 (Source: Uniprot.org, NCBI)

Gene Name

FOXI2

Full Name

Forkhead box protein I2

Weight

32.8 kDa

Alternative Names

FLJ46831; forkhead box I2; forkhead box protein I2; homolog of mouse Foxi2 Foxi2|Fkhl5, Foxf1|forkhead box I2|forkhead box protein I2|HFH-5|HNF-3/fork-head homolog-5 (HFH-5)|hepatocyte nuclear factor 3 forkhead homolog 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FOXI2, check out the FOXI2 Infographic

FOXI2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FOXI2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6ZQN5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FOXI2 (NM_207426) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FOXI2 (NM_207426) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FOXI2 (NM_207426) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6ZQN5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product