Follistatin (FST) (NM_013409) Human Recombinant Protein

Follistatin protein,

Product Info Summary

SKU: PROTP19883
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Follistatin (FST) (NM_013409) Human Recombinant Protein

View all Follistatin recombinant proteins

SKU/Catalog Number

PROTP19883

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human follistatin (FST), transcript variant FST344

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Follistatin (FST) (NM_013409) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19883)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.7 kDa

Amino Acid Sequence

MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Validation Images & Assay Conditions

Gene/Protein Information For FST (Source: Uniprot.org, NCBI)

Gene Name

FST

Full Name

Follistatin

Weight

34.7 kDa

Alternative Names

follistatin isoform FST317; Follistatin; FS; FSActivin-binding protein; FST FST FS follistatin follistatin|activin-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FST, check out the FST Infographic

FST infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FST: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP19883

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Follistatin (FST) (NM_013409) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Follistatin (FST) (NM_013409) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Follistatin (FST) (NM_013409) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP19883
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.