FKBP2 (NM_057092) Human Recombinant Protein

FKBP13/FKBP2 protein,

Product Info Summary

SKU: PROTP26885
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FKBP2 (NM_057092) Human Recombinant Protein

View all FKBP13/FKBP2 recombinant proteins

SKU/Catalog Number

PROTP26885

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FKBP2 (NM_057092) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP26885)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.3 kDa

Amino Acid Sequence

MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Validation Images & Assay Conditions

Gene/Protein Information For FKBP2 (Source: Uniprot.org, NCBI)

Gene Name

FKBP2

Full Name

Peptidyl-prolyl cis-trans isomerase FKBP2

Weight

13.3 kDa

Superfamily

FKBP-type PPIase family

Alternative Names

EC 5.2.1.8,13 kDa FK506-binding protein; FK506 binding protein 2, 13kDa; FK506-binding protein 2 (13kD); FK506-binding protein 2; FKBP13; FKBP13,13 kDa FKBP; FKBP-13proline isomerase; FKBP2; FKBP-2; Immunophilin FKBP13; peptidyl-prolyl cis-trans isomerase FKBP2; PPIase FKBP2; PPIase; rapamycin-binding protein; rotamase FKBP2 FKBP-13, FKBP13, PPIase FKBP prolyl isomerase 2 peptidyl-prolyl cis-trans isomerase FKBP2|13 kDa FK506-binding protein|13 kDa FKBP|FK506 binding protein 2, 13kDa|FK506-binding protein 2|PPIase FKBP2|epididymis secretory sperm binding protein|immunophilin FKBP13|proline isomerase|rapamycin-binding protein|rotamase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FKBP2, check out the FKBP2 Infographic

FKBP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FKBP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP26885

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FKBP2 (NM_057092) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FKBP2 (NM_057092) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FKBP2 (NM_057092) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP26885
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.