FHL3 (NM_004468) Human Recombinant Protein

FHL3 protein,

Product Info Summary

SKU: PROTQ13643
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FHL3 (NM_004468) Human Recombinant Protein

View all FHL3 recombinant proteins

SKU/Catalog Number

PROTQ13643

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human four and a half LIM domains 3 (FHL3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FHL3 (NM_004468) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13643)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31 kDa

Amino Acid Sequence

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Validation Images & Assay Conditions

Gene/Protein Information For FHL3 (Source: Uniprot.org, NCBI)

Gene Name

FHL3

Full Name

Four and a half LIM domains protein 3

Weight

31 kDa

Alternative Names

FHL-3; four and a half LIM domains 3; four and a half LIM domains protein 3; LIM-only protein FHL3; MGC19547; MGC8696; Skeletal muscle LIM-protein 2; SLIM-2; SLIM2MGC23614 FHL3 SLIM2 four and a half LIM domains 3 four and a half LIM domains protein 3|FHL-3|LIM-only protein FHL3|SLIM-2|skeletal muscle LIM-protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FHL3, check out the FHL3 Infographic

FHL3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FHL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13643

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FHL3 (NM_004468) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FHL3 (NM_004468) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FHL3 (NM_004468) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13643
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product