FAU (NM_001997) Human Recombinant Protein

FUBI/MNSF beta/FAU protein,

Recombinant protein of human Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (FAU)

Product Info Summary

SKU: PROTP35544
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAU (NM_001997) Human Recombinant Protein

View all FUBI/MNSF beta/FAU recombinant proteins

SKU/Catalog Number

PROTP35544

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (FAU)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAU (NM_001997) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP35544)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.2 kDa

Amino Acid Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Validation Images & Assay Conditions

Gene/Protein Information For FAU (Source: Uniprot.org, NCBI)

Gene Name

FAU

Full Name

Ubiquitin-like protein FUBI

Weight

14.2 kDa

Superfamily

ubiquitin family

Alternative Names

40S Ribosomal Protein S30; asr1; FAU; FAU1; FAU-encoded ubiquitin-like protein; FBR-MuSV-associated ubiquitously expressed; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed(fox derived); FLJ22986; Fub1; FUBI; MNSFbeta; monoclonal nonspecific suppressor factor beta; ribosomal protein S30; RPS30; S30; ubiquitin-like protein fubi and ribosomal protein S30; ubiquitin-like-S30 fusion protein FAU FAU1, Fub1, Fubi, MNSFbeta, RPS30, S30, asr1 FAU ubiquitin like and ribosomal protein S30 fusion ubiquitin-like protein fubi and ribosomal protein S30|40S ribosomal protein S30|FAU-encoded ubiquitin-like protein|FBR-MuSV-associated ubiquitously expressed|Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived)| nonspecific suppressor factor beta|ribosomal protein S30|small ribosomal subunit protein eS30|ubiquitin-like-S30 fusion protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAU, check out the FAU Infographic

FAU infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAU: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP35544

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAU (NM_001997) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAU (NM_001997) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAU (NM_001997) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP35544
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.