FAM72D (NM_207418) Human Recombinant Protein

FAM72D protein,

Recombinant protein of human gastric cancer up-regulated-2 (GCUD2)

Product Info Summary

SKU: PROTQ6L9T8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM72D (NM_207418) Human Recombinant Protein

View all FAM72D recombinant proteins

SKU/Catalog Number

PROTQ6L9T8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human gastric cancer up-regulated-2 (GCUD2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM72D (NM_207418) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6L9T8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.5 kDa

Amino Acid Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR

Validation Images & Assay Conditions

Gene/Protein Information For FAM72D (Source: Uniprot.org, NCBI)

Gene Name

FAM72D

Full Name

Protein FAM72D

Weight

16.5 kDa

Superfamily

FAM72 family

Alternative Names

Protein FAM72D FAM72D GCUD2 family with sequence similarity 72 member D protein FAM72D|gastric cancer up-regulated protein 2|gastric cancer up-regulated-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM72D, check out the FAM72D Infographic

FAM72D infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM72D: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6L9T8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM72D (NM_207418) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM72D (NM_207418) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM72D (NM_207418) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6L9T8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.