FAM50A (NM_004699) Human Recombinant Protein

FAM50A protein,

Product Info Summary

SKU: PROTQ14320
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM50A (NM_004699) Human Recombinant Protein

View all FAM50A recombinant proteins

SKU/Catalog Number

PROTQ14320

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 50, member A (FAM50A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM50A (NM_004699) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14320)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.1 kDa

Amino Acid Sequence

MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

Validation Images & Assay Conditions

Gene/Protein Information For FAM50A (Source: Uniprot.org, NCBI)

Gene Name

FAM50A

Full Name

Protein FAM50A

Weight

40.1 kDa

Superfamily

FAM50 family

Alternative Names

DXS9928EXAP-5 protein; family with sequence similarity 50, member A; HXC-26; Protein HXC-26; Protein XAP-5; XAP5HXC26,9F FAM50A 9F, DXS9928E, HXC-26, HXC26, MRXSA, XAP5 family with sequence similarity 50 member A protein FAM50A|protein XAP-5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM50A, check out the FAM50A Infographic

FAM50A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM50A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14320

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM50A (NM_004699) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM50A (NM_004699) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM50A (NM_004699) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14320
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.