FAM32A (NM_014077) Human Recombinant Protein

FAM32A protein,

Recombinant protein of human family with sequence similarity 32, member A (FAM32A)

Product Info Summary

SKU: PROTQ9Y421
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM32A (NM_014077) Human Recombinant Protein

View all FAM32A recombinant proteins

SKU/Catalog Number

PROTQ9Y421

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 32, member A (FAM32A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM32A (NM_014077) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y421)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13 kDa

Amino Acid Sequence

MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK

Validation Images & Assay Conditions

Gene/Protein Information For FAM32A (Source: Uniprot.org, NCBI)

Gene Name

FAM32A

Full Name

Protein FAM32A

Weight

13 kDa

Superfamily

FAM32 family

Alternative Names

DKFZP586O0120; family with sequence similarity 32, member A; hypothetical protein LOC26017 FAM32A OTAG-12, OTAG12 family with sequence similarity 32 member A protein FAM32A|ovarian tumor associated gene-12

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM32A, check out the FAM32A Infographic

FAM32A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM32A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y421

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM32A (NM_014077) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM32A (NM_014077) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM32A (NM_014077) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y421
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.