FAM177B (NM_207468) Human Recombinant Protein

FAM177B protein,

Recombinant protein of human family with sequence similarity 177, member B (FAM177B)

Product Info Summary

SKU: PROTA6PVY3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM177B (NM_207468) Human Recombinant Protein

View all FAM177B recombinant proteins

SKU/Catalog Number

PROTA6PVY3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 177, member B (FAM177B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM177B (NM_207468) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6PVY3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18 kDa

Amino Acid Sequence

MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDPSKLSWGPYLRFWAGRIASTSFSTCEFLGGRFAVFFGLTQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVQEYGTIQQDVTEAIPQ

Validation Images & Assay Conditions

Gene/Protein Information For FAM177B (Source: Uniprot.org, NCBI)

Gene Name

FAM177B

Full Name

Protein FAM177B

Weight

18 kDa

Superfamily

FAM177 family

Alternative Names

Family With Sequence Similarity 177, Member B; Protein FAM177B; RP11-452F19.2 FAM177B family with sequence similarity 177 member B protein FAM177B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM177B, check out the FAM177B Infographic

FAM177B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM177B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used FAM177B (NM_207468) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM177B (NM_207468) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM177B (NM_207468) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6PVY3
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.