FAM167B (NM_032648) Human Recombinant Protein

FAM167B protein,

Recombinant protein of human family with sequence similarity 167, member B (FAM167B)

Product Info Summary

SKU: PROTQ9BTA0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM167B (NM_032648) Human Recombinant Protein

View all FAM167B recombinant proteins

SKU/Catalog Number

PROTQ9BTA0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 167, member B (FAM167B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM167B (NM_032648) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BTA0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.2 kDa

Amino Acid Sequence

MSLGLLKFQAVGEEDEEDEEGESLDSVKALTAKLQLQTRRPSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREMQAQDRQLAGQLLRLRAQLHRLKMDQACHLHQELLDEAELELELEPGAGLALAPLLRHLGLTRMNISARRFTLC

Validation Images & Assay Conditions

Gene/Protein Information For FAM167B (Source: Uniprot.org, NCBI)

Gene Name

FAM167B

Full Name

Protein FAM167B

Weight

18.2 kDa

Superfamily

FAM167 (SEC) family

Alternative Names

C1orf90; chromosome 1 open reading frame 90; family with sequence similarity 167, member B; hypothetical protein LOC84734; MGC10820 FAM167B C1orf90, DIORA-2 family with sequence similarity 167 member B protein FAM167B|disordered autoimmunity 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM167B, check out the FAM167B Infographic

FAM167B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM167B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used FAM167B (NM_032648) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM167B (NM_032648) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM167B (NM_032648) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BTA0
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.