FAM119A (METTL21A) (NM_145280) Human Recombinant Protein

FAM119A protein,

Product Info Summary

SKU: PROTQ8WXB1
Size: 20 µg
Source: HEK293T

Product Name

FAM119A (METTL21A) (NM_145280) Human Recombinant Protein

View all FAM119A recombinant proteins

SKU/Catalog Number

PROTQ8WXB1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 119, member A (FAM119A), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM119A (METTL21A) (NM_145280) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WXB1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.4 kDa

Amino Acid Sequence

MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL

Validation Images & Assay Conditions

Gene/Protein Information For METTL21A (Source: Uniprot.org, NCBI)

Gene Name

METTL21A

Full Name

Protein N-lysine methyltransferase METTL21A

Weight

24.4 kDa

Superfamily

methyltransferase superfamily

Alternative Names

EC 2.1.1.-; FAM119A; HCA557B; Hepatocellular carcinoma-associated antigen 557b; hypothetical protein LOC151194; LOC151194; member A; methyltransferase like 21A; MGC45373

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on METTL21A, check out the METTL21A Infographic

METTL21A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for METTL21A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WXB1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM119A (METTL21A) (NM_145280) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM119A (METTL21A) (NM_145280) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM119A (METTL21A) (NM_145280) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WXB1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.