EVA1 (MPZL2) (NM_005797) Human Recombinant Protein

EVA1/MPZL2 protein,

Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 1

Product Info Summary

SKU: PROTO60487
Size: 20 µg
Source: HEK293T

Product Name

EVA1 (MPZL2) (NM_005797) Human Recombinant Protein

View all EVA1/MPZL2 recombinant proteins

SKU/Catalog Number

PROTO60487

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EVA1 (MPZL2) (NM_005797) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60487)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.7 kDa

Amino Acid Sequence

MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD

Validation Images & Assay Conditions

Gene/Protein Information For MPZL2 (Source: Uniprot.org, NCBI)

Gene Name

MPZL2

Full Name

Myelin protein zero-like protein 2

Weight

21.7 kDa

Superfamily

myelin P0 protein family

Alternative Names

EVA1; EVAEpithelial V-like antigen 1EVA1myelin protein zero-like protein 2; MPZL2; myelin protein zero-like 2 MPZL2 DFNB111, EVA, EVA1 myelin protein zero like 2 myelin protein zero-like protein 2|epithelial V-like antigen 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MPZL2, check out the MPZL2 Infographic

MPZL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MPZL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60487

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EVA1 (MPZL2) (NM_005797) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EVA1 (MPZL2) (NM_005797) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EVA1 (MPZL2) (NM_005797) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60487
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.