ESE1 (ELF3) (NM_004433) Human Recombinant Protein

ELF3/ESE-1 protein,

Recombinant protein of human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1

Product Info Summary

SKU: PROTP78545
Size: 20 µg
Source: HEK293T

Product Name

ESE1 (ELF3) (NM_004433) Human Recombinant Protein

View all ELF3/ESE-1 recombinant proteins

SKU/Catalog Number

PROTP78545

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ESE1 (ELF3) (NM_004433) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP78545)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.3 kDa

Amino Acid Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN

Validation Images & Assay Conditions

Gene/Protein Information For ELF3 (Source: Uniprot.org, NCBI)

Gene Name

ELF3

Full Name

ETS-related transcription factor Elf-3

Weight

41.3 kDa

Superfamily

ETS family

Alternative Names

E74-like factor 3 (ets domain transcription factor, epithelial-specific ); E74-like factor 3; ELF3; Epithelial-restricted with serine box; epithelial-specific); Epithelium-restricted Ets protein ESX; Epithelium-specific Ets transcription factor 1; EPR1; EPR-1; ERT; ESX; ets domain transcription factor, serine box (epithelial-specific); ETS-related transcription factor Elf-3; JEN; serine box ELF3 EPR-1, ERT, ESE-1, ESX E74 like ETS transcription factor 3 ETS-related transcription factor Elf-3|E74-like factor 3 (ETS domain transcription factor, serine box, epithelial-specific)|E74-like factor 3 (ets domain transcription factor)|E74-like factor 3 (ets domain transcription factor, epithelial-specific )|epithelial-restricted with serine box|epithelium-restricted Ets protein ESX|epithelium-specific Ets transcription factor 1|ets domain transcription factor, serine box (epithelial-specific)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ELF3, check out the ELF3 Infographic

ELF3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ELF3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP78545

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ESE1 (ELF3) (NM_004433) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ESE1 (ELF3) (NM_004433) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ESE1 (ELF3) (NM_004433) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP78545
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product