ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein

TXNDC12 protein,

Product Info Summary

SKU: PROTO95881
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein

View all TXNDC12 recombinant proteins

SKU/Catalog Number

PROTO95881

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95881)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19 kDa

Amino Acid Sequence

METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

Validation Images & Assay Conditions

Gene/Protein Information For TXNDC12 (Source: Uniprot.org, NCBI)

Gene Name

TXNDC12

Full Name

Thioredoxin domain-containing protein 12

Weight

19 kDa

Alternative Names

Thioredoxin domain-containing protein 12 TXNDC12 AG1, AGR1, ERP16, ERP18, ERP19, PDIA16, TLP19, hAG-1, hTLP19 thioredoxin domain containing 12 thioredoxin domain-containing protein 12|ER protein 18|ER protein 19|anterior gradient homolog 1|endoplasmic reticulum protein ERp19|endoplasmic reticulum resident protein 18|endoplasmic reticulum resident protein 19|endoplasmic reticulum thioredoxin superfamily member, 18 kDa|protein disulfide isomerase family A, member 16|thioredoxin domain containing 12 (endoplasmic reticulum)|thioredoxin-like protein p19

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TXNDC12, check out the TXNDC12 Infographic

TXNDC12 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TXNDC12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95881

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ERp19 (TXNDC12) (NM_015913) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95881
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.