ERMAP (NM_018538) Human Recombinant Protein

Ermap protein,

Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2

Product Info Summary

SKU: PROTQ96PL5
Size: 20 µg
Source: HEK293T

Product Name

ERMAP (NM_018538) Human Recombinant Protein

View all Ermap recombinant proteins

SKU/Catalog Number

PROTQ96PL5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ERMAP (NM_018538) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96PL5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

49.5 kDa

Amino Acid Sequence

MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF

Validation Images & Assay Conditions

Gene/Protein Information For ERMAP (Source: Uniprot.org, NCBI)

Gene Name

ERMAP

Full Name

Erythroid membrane-associated protein

Weight

49.5 kDa

Superfamily

immunoglobulin superfamily

Alternative Names

ERMAP; erythroblast membrane-associated protein (RD and SC blood groups); erythroblast membrane-associated protein (Scianna blood group); erythroblast membrane-associated protein; erythroid membrane-associated protein; hERMAP; MGC118810; MGC118811; PRO2801; Radin blood group (Rd); Radin blood group antigen; Radin blood group; RD; RDMGC118812; SC; Scianna blood group (Sc); Scianna blood group antigen; Scianna blood group; SCMGC118813

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ERMAP, check out the ERMAP Infographic

ERMAP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ERMAP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96PL5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ERMAP (NM_018538) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ERMAP (NM_018538) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ERMAP (NM_018538) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96PL5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product