ERH (NM_004450) Human Recombinant Protein

ERH protein,

Product Info Summary

SKU: PROTP84090
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ERH (NM_004450) Human Recombinant Protein

View all ERH recombinant proteins

SKU/Catalog Number

PROTP84090

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human enhancer of rudimentary homolog (Drosophila) (ERH)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ERH (NM_004450) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP84090)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.1 kDa

Amino Acid Sequence

MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

Validation Images & Assay Conditions

Gene/Protein Information For ERH (Source: Uniprot.org, NCBI)

Gene Name

ERH

Full Name

Enhancer of rudimentary homolog

Weight

12.1 kDa

Superfamily

E(R) family

Alternative Names

DROER; enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary homolog; FLJ27340 ERH DROER ERH mRNA splicing and mitosis factor enhancer of rudimentary homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ERH, check out the ERH Infographic

ERH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ERH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP84090

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ERH (NM_004450) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ERH (NM_004450) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ERH (NM_004450) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP84090
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.