ELK4 (NM_021795) Human Recombinant Protein

ELK4 protein,

Recombinant protein of human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b

Product Info Summary

SKU: PROTP28324
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ELK4 (NM_021795) Human Recombinant Protein

View all ELK4 recombinant proteins

SKU/Catalog Number

PROTP28324

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ELK4 (NM_021795) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP28324)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

44.5 kDa

Amino Acid Sequence

MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM

Validation Images & Assay Conditions

Gene/Protein Information For ELK4 (Source: Uniprot.org, NCBI)

Gene Name

ELK4

Full Name

ETS domain-containing protein Elk-4

Weight

44.5 kDa

Superfamily

ETS family

Alternative Names

ELK4, ETS-domain protein (SRF accessory protein 1); ETS-domain protein; SAP-1; SAP1ETS domain-containing protein Elk-4; Serum response factor accessory protein 1; SRF accessory protein 1 ELK4 SAP1 ETS transcription factor ELK4 ETS domain-containing protein Elk-4|ELK4, ETS transcription factor|ELK4, ETS-domain protein (SRF accessory protein 1)|SAP-1|serum response factor accessory protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ELK4, check out the ELK4 Infographic

ELK4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ELK4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP28324

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ELK4 (NM_021795) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ELK4 (NM_021795) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ELK4 (NM_021795) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP28324
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.