EIF4H (NM_031992) Human Recombinant Protein

EIF4H protein,

Product Info Summary

SKU: PROTQ15056
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EIF4H (NM_031992) Human Recombinant Protein

View all EIF4H recombinant proteins

SKU/Catalog Number

PROTQ15056

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 4H (EIF4H), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EIF4H (NM_031992) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15056)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25 kDa

Amino Acid Sequence

MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

Validation Images & Assay Conditions

Gene/Protein Information For EIF4H (Source: Uniprot.org, NCBI)

Gene Name

EIF4H

Full Name

Eukaryotic translation initiation factor 4H

Weight

25 kDa

Alternative Names

eukaryotic translation initiation factor 4H; KIAA0038eIF-4H; WBSCR1; Williams-Beuren syndrome chromosome region 1; WSCR1Williams-Beuren syndrome chromosomal region 1 protein EIF4H WBSCR1, WSCR1, eIF-4H eukaryotic translation initiation factor 4H eukaryotic translation initiation factor 4H|Williams-Beuren syndrome chromosome region 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF4H, check out the EIF4H Infographic

EIF4H infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF4H: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15056

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EIF4H (NM_031992) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EIF4H (NM_031992) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EIF4H (NM_031992) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15056
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.