Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein

Dynein light chain 4 protein,

Product Info Summary

SKU: PROTO96015
Size: 20 µg
Source: HEK293T

Product Name

Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein

View all Dynein light chain 4 recombinant proteins

SKU/Catalog Number

PROTO96015

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dynein, axonemal, light chain 4 (DNAL4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO96015)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.8 kDa

Amino Acid Sequence

MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS

Validation Images & Assay Conditions

Gene/Protein Information For DNAL4 (Source: Uniprot.org, NCBI)

Gene Name

DNAL4

Full Name

Dynein light chain 4, axonemal

Weight

11.8 kDa

Superfamily

dynein light chain family

Alternative Names

dJ327J16; dynein light chain 4, axonemal; dynein light chain, outer arm 4; dynein, axonemal, light 4; dynein, axonemal, light chain 4; dynein, axonemal, light polypeptide 4; PIG27; proliferation-inducing gene 27; proliferation-inducing protein 27 DNAL4 MRMV3, PIG27 dynein axonemal light chain 4 dynein light chain 4, axonemal|dynein light chain, outer arm 4|dynein, axonemal, light polypeptide 4|proliferation-inducing gene 27|proliferation-inducing protein 27

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DNAL4, check out the DNAL4 Infographic

DNAL4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DNAL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO96015

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO96015
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.