DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein

DPH4 protein,

Product Info Summary

SKU: PROTQ6P3W2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein

View all DPH4 recombinant proteins

SKU/Catalog Number

PROTQ6P3W2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6P3W2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17 kDa

Amino Acid Sequence

MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN

Validation Images & Assay Conditions

Gene/Protein Information For DNAJC24 (Source: Uniprot.org, NCBI)

Gene Name

DNAJC24

Full Name

DnaJ homolog subfamily C member 24

Weight

17 kDa

Superfamily

DPH4 family

Alternative Names

CSL-type zinc finger-containing protein 3; DnaJ (Hsp40) homolog, subfamily C, member 24; dnaJ homolog subfamily C member 24; DPH4 homolog; DPH4, JJJ3 homolog (S. cerevisiae); DPH4, JJJ3 homolog; DPH41700030A21Rik; JJJ3; S. cerevisiae); ZCSL3; zinc finger, CSL domain containing 3; zinc finger, CSL-type containing 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DNAJC24, check out the DNAJC24 Infographic

DNAJC24 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DNAJC24: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6P3W2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DPH4 (DNAJC24) (NM_181706) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6P3W2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.