DIRAS2 (NM_017594) Human Recombinant Protein

DIRAS2 protein,

Recombinant protein of human DIRAS family, GTP-binding RAS-like 2 (DIRAS2)

Product Info Summary

SKU: PROTQ96HU8
Size: 20 µg
Source: HEK293T

Product Name

DIRAS2 (NM_017594) Human Recombinant Protein

View all DIRAS2 recombinant proteins

SKU/Catalog Number

PROTQ96HU8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DIRAS family, GTP-binding RAS-like 2 (DIRAS2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DIRAS2 (NM_017594) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96HU8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.3 kDa

Amino Acid Sequence

MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM

Validation Images & Assay Conditions

Gene/Protein Information For DIRAS2 (Source: Uniprot.org, NCBI)

Gene Name

DIRAS2

Full Name

GTP-binding protein Di-Ras2

Weight

22.3 kDa

Superfamily

small GTPase superfamily

Alternative Names

DIRAS family, GTP-binding RAS-like 2; Di-Ras2; Distinct subgroup of the Ras family member 2; DKFZp761C07121; GTP-binding protein Di-Ras2 DIRAS2 Di-Ras2 DIRAS family GTPase 2 GTP-binding protein Di-Ras2|DIRAS family, GTP-binding RAS-like 2|distinct subgroup of the Ras family member 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DIRAS2, check out the DIRAS2 Infographic

DIRAS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DIRAS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96HU8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DIRAS2 (NM_017594) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DIRAS2 (NM_017594) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DIRAS2 (NM_017594) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96HU8
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product