Destrin (DSTN) (NM_006870) Human Recombinant Protein

Destrin protein,

Product Info Summary

SKU: PROTP60981
Size: 20 µg
Source: HEK293T

Product Name

Destrin (DSTN) (NM_006870) Human Recombinant Protein

View all Destrin recombinant proteins

SKU/Catalog Number

PROTP60981

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human destrin (actin depolymerizing factor) (DSTN), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Destrin (DSTN) (NM_006870) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP60981)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.3 kDa

Amino Acid Sequence

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV

Validation Images & Assay Conditions

Gene/Protein Information For DSTN (Source: Uniprot.org, NCBI)

Gene Name

DSTN

Full Name

Destrin

Weight

18.3 kDa

Superfamily

actin-binding proteins ADF family

Alternative Names

ACTDPdestrin; Actin-depolymerizing factor; ADFbA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP)); bA462D18.2; destrin (actin depolymerizing factor); DSN DSTN ACTDP, ADF, HEL32, bA462D18.2 destrin, actin depolymerizing factor destrin|actin-depolymerizing factor|bA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP))|epididymis luminal protein 32|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DSTN, check out the DSTN Infographic

DSTN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DSTN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP60981

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Destrin (DSTN) (NM_006870) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Destrin (DSTN) (NM_006870) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Destrin (DSTN) (NM_006870) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP60981
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.