DEPDC7 (NM_001077242) Human Recombinant Protein

DEPDC7 protein,

Recombinant protein of human DEP domain containing 7 (DEPDC7), transcript variant 1

Product Info Summary

SKU: PROTQ96QD5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DEPDC7 (NM_001077242) Human Recombinant Protein

View all DEPDC7 recombinant proteins

SKU/Catalog Number

PROTQ96QD5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DEP domain containing 7 (DEPDC7), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DEPDC7 (NM_001077242) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96QD5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

58.1 kDa

Amino Acid Sequence

MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD

Validation Images & Assay Conditions

Gene/Protein Information For DEPDC7 (Source: Uniprot.org, NCBI)

Gene Name

DEPDC7

Full Name

DEP domain-containing protein 7

Weight

58.1 kDa

Superfamily

DEPDC7 family

Alternative Names

DEP domain containing 7; DEP domain-containing protein 7; dJ85M6.4 (novel 58.3 KDA protein); dJ85M6.4; novel 58.3 KDA protein; Protein TR2/D15; TR2 DEPDC7 TR2, dJ85M6.4 DEP domain containing 7 DEP domain-containing protein 7|dJ85M6.4 (novel 58.3 KDA protein)|novel 58.3 KDA protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DEPDC7, check out the DEPDC7 Infographic

DEPDC7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DEPDC7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96QD5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DEPDC7 (NM_001077242) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DEPDC7 (NM_001077242) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DEPDC7 (NM_001077242) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96QD5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.