DEFB118 (NM_054112) Human Recombinant Protein

DEFB118 protein,

Product Info Summary

SKU: PROTQ96PH6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DEFB118 (NM_054112) Human Recombinant Protein

View all DEFB118 recombinant proteins

SKU/Catalog Number

PROTQ96PH6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human defensin, beta 118 (DEFB118)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DEFB118 (NM_054112) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96PH6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.4 kDa

Amino Acid Sequence

MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS

Validation Images & Assay Conditions

Gene/Protein Information For DEFB118 (Source: Uniprot.org, NCBI)

Gene Name

DEFB118

Full Name

Beta-defensin 118

Weight

13.4 kDa

Superfamily

beta-defensin family

Alternative Names

Beta-defensin 118 DEFB118 C20orf63, DEFB-18, ESC42, ESP13.6 defensin beta 118 beta-defensin 118|defensin, beta 18|epididymal secretory protein 13.6|epididymis secretory sperm binding protein|epididymus specific clone 42

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DEFB118, check out the DEFB118 Infographic

DEFB118 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DEFB118: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used DEFB118 (NM_054112) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DEFB118 (NM_054112) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DEFB118 (NM_054112) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96PH6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.