DCTD (NM_001921) Human Recombinant Protein

Deoxycytidylate deaminase protein,

Product Info Summary

SKU: PROTP32321
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DCTD (NM_001921) Human Recombinant Protein

View all Deoxycytidylate deaminase recombinant proteins

SKU/Catalog Number

PROTP32321

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dCMP deaminase (DCTD), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DCTD (NM_001921) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP32321)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.8 kDa

Amino Acid Sequence

MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ

Validation Images & Assay Conditions

Gene/Protein Information For DCTD (Source: Uniprot.org, NCBI)

Gene Name

DCTD

Full Name

Deoxycytidylate deaminase

Weight

19.8 kDa

Superfamily

cytidine and deoxycytidylate deaminase family

Alternative Names

dCMP deaminaseEC 3.5.4.12; deoxycytidylate deaminase; MGC111062 DCTD dCMP deaminase deoxycytidylate deaminase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DCTD, check out the DCTD Infographic

DCTD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DCTD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP32321

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DCTD (NM_001921) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DCTD (NM_001921) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DCTD (NM_001921) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP32321
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.