CUTA (NM_001014838) Human Recombinant Protein

CUTA protein,

Product Info Summary

SKU: PROTO60888
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CUTA (NM_001014838) Human Recombinant Protein

View all CUTA recombinant proteins

SKU/Catalog Number

PROTO60888

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CUTA (NM_001014838) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60888)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.7 kDa

Amino Acid Sequence

MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

Validation Images & Assay Conditions

Gene/Protein Information For CUTA (Source: Uniprot.org, NCBI)

Gene Name

CUTA

Full Name

Protein CutA

Weight

16.7 kDa

Superfamily

CutA family

Alternative Names

Acetylcholinesterase-associated proteinBrain acetylcholinesterase putative membrane anchor; ACHAP; C6orf82; chromosome 6 open reading frame 82; cutA divalent cation tolerance homolog (E. coli); divalent cation tolerant protein CUTA; MGC111154; protein CutA CUTA ACHAP, C6orf82 cutA divalent cation tolerance homolog protein CutA|acetylcholinesterase-associated protein|brain acetylcholinesterase putative membrane anchor|divalent cation tolerant protein CUTA

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CUTA, check out the CUTA Infographic

CUTA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CUTA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60888

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CUTA (NM_001014838) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CUTA (NM_001014838) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CUTA (NM_001014838) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60888
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.