CTDSPL2 (NM_016396) Human Recombinant Protein

CTDSPL2 protein,

Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2 (CTDSPL2)

Product Info Summary

SKU: PROTQ05D32
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CTDSPL2 (NM_016396) Human Recombinant Protein

View all CTDSPL2 recombinant proteins

SKU/Catalog Number

PROTQ05D32

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2 (CTDSPL2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CTDSPL2 (NM_016396) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ05D32)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

52.8 kDa

Amino Acid Sequence

MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD

Validation Images & Assay Conditions

Gene/Protein Information For CTDSPL2 (Source: Uniprot.org, NCBI)

Gene Name

CTDSPL2

Full Name

CTD small phosphatase-like protein 2

Weight

52.8 kDa

Superfamily

CTDSPL2 family

Alternative Names

CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase like 2; CTD small phosphatase-like protein 2; CTDSP-like 2; EC 3.1.3; EC 3.1.3.-; EC 3.1.3.16; FLJ10523; HSPC129 CTDSPL2 HSPC058, HSPC129, SCP4 CTD small phosphatase like 2 CTD small phosphatase-like protein 2|CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2|CTDSP-like 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CTDSPL2, check out the CTDSPL2 Infographic

CTDSPL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CTDSPL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ05D32

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CTDSPL2 (NM_016396) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CTDSPL2 (NM_016396) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CTDSPL2 (NM_016396) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ05D32
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.