CTDSP1 (NM_021198) Human Recombinant Protein

CTDSP1 protein,

Product Info Summary

SKU: PROTQ9GZU7
Size: 20 µg
Source: HEK293T

Product Name

CTDSP1 (NM_021198) Human Recombinant Protein

View all CTDSP1 recombinant proteins

SKU/Catalog Number

PROTQ9GZU7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CTDSP1 (NM_021198) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZU7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29 kDa

Amino Acid Sequence

MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS

Validation Images & Assay Conditions

Gene/Protein Information For CTDSP1 (Source: Uniprot.org, NCBI)

Gene Name

CTDSP1

Full Name

Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

Weight

29 kDa

Alternative Names

carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 1; NIF3; NLI-IF; NLIIFEC 3.1.3.16; NLI-interacting factor 3; SCP1Nuclear LIM interactor-interacting factor 3; Small CTD phosphatase 1; Small C-terminal domain phosphatase 1 CTDSP1 NIF3, NLI-IF, NLIIF, SCP1 CTD small phosphatase 1 carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1|CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1|NLI-interacting factor 3|nuclear LIM interactor-interacting factor 3|small C-terminal domain phosphatase 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CTDSP1, check out the CTDSP1 Infographic

CTDSP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CTDSP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZU7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CTDSP1 (NM_021198) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CTDSP1 (NM_021198) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CTDSP1 (NM_021198) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZU7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.